SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017280 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017280
Domain Number 1 Region: 74-304
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.21e-28
Family Protein-L-isoaspartyl O-methyltransferase 0.004
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017280
Domain Number - Region: 320-337
Classification Level Classification E-value
Superfamily SOCS box-like 0.0628
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017280   Gene: ENSGGOG00000025636   Transcript: ENSGGOT00000034120
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:8:49618502:49696763:-1 gene:ENSGGOG00000025636 transcript:ENSGGOT00000034120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGN
IHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEY
AKEKLESFIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKIL
LKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV
RNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPL
DNHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences ENSGGOP00000017280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]