SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017281 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017281
Domain Number 1 Region: 260-542
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.18e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000215
Further Details:      
 
Domain Number 2 Region: 544-652
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.81e-26
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 3 Region: 187-259
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0000000000000102
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.01
Further Details:      
 
Domain Number 4 Region: 33-94
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000061
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017281   Gene: ENSGGOG00000006311   Transcript: ENSGGOT00000028824
Sequence length 661
Comment pep:known_by_projection chromosome:gorGor3.1:1:129349613:129368809:1 gene:ENSGGOG00000006311 transcript:ENSGGOT00000028824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRWLAERLGLFEELWAAQVKRLASMAQKEPRTIKISLPGGQKIDAVAWNTTPYQLARQIS
STLADTAVAAQVNGEPYDLERPLETDSDLRFLTFDSPEGKACIFNSNMAYTAEQTTWSPP
HLVFFISPKSLQEQQKTDWPPASMLWNWEAPRIEGWGWSFYALKEEKILAFFLFYKLKIL
KITNWPLLSPRCGTLVDLCQGPHLRHTGQIGGLKLLSNSSSLWRSSGAPQTLQRVSGISF
PTTELLRAWEAWREEAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRA
EYAHRGFSEVKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPGYTLALKPMNCPAHCLMFAH
RPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDF
LRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGP
KIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKSRQAGALERPVLIHRAVLGSVERLLG
VLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRI
RRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLSEAVQRLVELQNTRVPNAEEI
F
Download sequence
Identical sequences ENSGGOP00000017281 ENSGGOP00000017281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]