SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017288 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017288
Domain Number 1 Region: 23-185
Classification Level Classification E-value
Superfamily L domain-like 1.98e-30
Family Ngr ectodomain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017288   Gene: ENSGGOG00000007321   Transcript: ENSGGOT00000022189
Sequence length 299
Comment pep:known_by_projection chromosome:gorGor3.1:1:144703005:144722654:1 gene:ENSGGOG00000007321 transcript:ENSGGOT00000022189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
NENRITSLPAMHLGLLSDLVYLDCQNNRLIYLDLSSNNLTSISPFTFSVLSNLVQLNIAN
NPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLFLSGNPWKCNCSFLD
FAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHLDHKDYIFLLLIGFC
IFAAGTVAAWLTGVCAVLYQNTRHKSSEEDEDEAGTRVEVSRRIFQTQTSSVQEFPQLI
Download sequence
Identical sequences ENSGGOP00000017288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]