SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017309 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017309
Domain Number 1 Region: 306-538
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.53e-36
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 2 Region: 1350-1599
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 1028-1187,1224-1301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.37e-28
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 4 Region: 6-64,109-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-20
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017309   Gene: ENSGGOG00000008660   Transcript: ENSGGOT00000027496
Sequence length 2040
Comment pep:known_by_projection chromosome:gorGor3.1:19:13463910:13628383:-1 gene:ENSGGOG00000008660 transcript:ENSGGOT00000027496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGA
LRRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYI
RRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYG
LGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASL
RNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMT
VFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTS
EMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSR
AAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGR
ESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEHRRHR
AHRRRRHRHGAPATYEGDARREDKERRHRRRKGAIAHFRDEQDLMSKKKKERQSHSCPIT
SPHLIRSQGLIQMMRKYSQPGFHDTQLLKKHHNLASGKPSGESQDRFMGNQGCVVQGARH
GGSIYPALFLVTGSHSAASRWTPNNPGNPSNPGPPKTPENSLIVTNPSGTQTNSAKTARK
PDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKRGEDGPKPMPPYSSMFILSTTNPLRR
LCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIK
MIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLK
TIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEK
DCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFE
NQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACI
DFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYE
NALRVFNIVFTSLFSLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFI
NLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG
NIGIDVEDEDSDEDEFQITEHNNFTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSG
ILTRECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVW
AEYDPAACGRIHYKDMYSLLRVISPPLGLGKKCPHRVACKVLTRNTRPTLFFHSAHFLST
LSFLSSRLRGCKFLKRGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKI
YAAMMIMEYYRQSKAKKLQAMREEQDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGG
ALMAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRDGY
SDSEHYLPMEGQGRAASMPRLPAENQRRRGRPRGNNLSVCTAHQPHDVFTLRAGPKSRRL
YDYSWNLSPPDEILLHHQRRSVRRHWVYEGSLARTPRPGPGLGTDLSMTTQSGDLPSKER
DQERGRPKDRKHRPPPPDKDRYAQERPDHGRARARDQRWSRSPSEGREHMAHRQVGAAAS
Download sequence
Identical sequences ENSGGOP00000017309 ENSGGOP00000008481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]