SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017322 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017322
Domain Number 1 Region: 1770-2016
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 393-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000322
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 1086-1218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 860-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000268
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 543-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000322
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 731-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 897-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000698
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 240-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000116
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 962-1102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000154
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 706-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000016
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 11 Region: 94-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 209-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000897
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 130-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 14 Region: 13-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000541
Family EGF-type module 0.014
Further Details:      
 
Domain Number 15 Region: 1255-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000875
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 1374-1406
Classification Level Classification E-value
Superfamily Notch domain 0.0000000994
Family Notch domain 0.0015
Further Details:      
 
Domain Number 17 Region: 665-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 1327-1365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 19 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000133
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 20 Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 21 Region: 1453-1484
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 22 Region: 1213-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000914
Family EGF-type module 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017322
Domain Number - Region: 936-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family EGF-type module 0.0073
Further Details:      
 
Domain Number - Region: 1416-1447
Classification Level Classification E-value
Superfamily Notch domain 0.00129
Family Notch domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017322   Gene: ENSGGOG00000004007   Transcript: ENSGGOT00000030138
Sequence length 2421
Comment pep:known_by_projection chromosome:gorGor3.1:1:123098970:123194087:-1 gene:ENSGGOG00000004007 transcript:ENSGGOT00000030138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPEGLLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFV
SRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCL
TGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCV
NGGICRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWT
GQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGS
TCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGAD
CTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATC
LDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQI
DIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY
TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCAS
NPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEG
PHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGT
CDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQ
TVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNT
QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMN
ECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSC
LCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSP
CKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGN
THYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCQCVPGYQGVNCEYEVDEC
QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCR
CLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGGRHCETFVDVCPQ
MPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPS
PRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYC
ADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECL
FDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIV
VLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSL
PGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSES
LTPERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPV
GQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWT
QQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDED
AEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMG
RCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADV
NAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILL
DHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRS
FLSLKHTPMGKKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSP
VDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPL
AHGASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGM
VLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPP
AVAGPLPTMYQVPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQH
SYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGG
GQRGPGTHMSEPPHNNMQVYA
Download sequence
Identical sequences ENSGGOP00000017322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]