SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017380 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017380
Domain Number 1 Region: 79-434
Classification Level Classification E-value
Superfamily DNase I-like 1.31e-35
Family Sphingomyelin phosphodiesterase-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017380
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily L domain-like 0.00156
Family Ngr ectodomain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017380   Gene: ENSGGOG00000027134   Transcript: ENSGGOT00000028905
Sequence length 449
Comment pep:novel chromosome:gorGor3.1:15:35070585:35073236:-1 gene:ENSGGOG00000027134 transcript:ENSGGOT00000028905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYLKNNXLRVLPYELGRLFQLQTLGLKGNPLSQDILNLYQGPDGTRKLLNFVLDNLAVHP
EQLPPRPWITFKELDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIME
EIVNCDAEIISLQEVETEQYFTLFLPALKEHEYDGFFSPKSRAKIMSEQERKHVDGCAIF
FKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVTVVLEVHKELFGAGMKPI
HAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKTILEKASSRSGSPAADPNSIPLV
LCADLNSLPDSGVVEHLSNGGIADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQL
KNAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIP
SDHFLMLTQLEIHPPLLPLVNGVHLPNRR
Download sequence
Identical sequences ENSGGOP00000017380 ENSGGOP00000017380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]