SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017422 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017422
Domain Number 1 Region: 134-300,422-501
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.63e-48
Family Bacterial dinuclear zinc exopeptidases 0.00000000255
Further Details:      
 
Domain Number 2 Region: 295-408
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000139
Family Bacterial exopeptidase dimerisation domain 0.0054
Further Details:      
 
Domain Number 3 Region: 77-134
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000182
Family Ccg1/TafII250-interacting factor B (Cib) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017422   Gene: ENSGGOG00000016084   Transcript: ENSGGOT00000027193
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:3:53307170:53321213:1 gene:ENSGGOG00000016084 transcript:ENSGGOT00000027193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGALCGCWFRLGGARPLIPFGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS
WLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS
QRGYRAVALDLPGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNS
HTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTI
HMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVT
STGRPGHASRFMEDTAAEKLHKVVSSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGG
VAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDD
SNPWWAAFSRVCKDMQWTGPECWLFPNGSSSPLQVGVPALGFSPMNRTPVLLHDHDERLH
EAVFLRGVDIYTRLLPALASVPALPSDS
Download sequence
Identical sequences ENSGGOP00000017422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]