SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017425 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017425
Domain Number 1 Region: 474-722
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-23
Family Galacturonase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017425   Gene: ENSGGOG00000003484   Transcript: ENSGGOT00000025455
Sequence length 722
Comment pep:known_by_projection chromosome:gorGor3.1:1:162444871:162509044:-1 gene:ENSGGOG00000003484 transcript:ENSGGOT00000025455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPQDPALYPQALHPLALGRASHPSQSRNTPPGRPRAAARCPPRSAPIGQSGRGREKWPT
AASALELLRRWRRSKASVPADSFRTISPDRRGEKAASAVSGDTAAATTLKGTASPVRSVV
ASPRPVKGKAGRETARLRLQRLPAAQAEDPGEAAAAAEEEPLLPVPEDEEEAQPLPPVCV
SRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVK
YEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPFSSNIANIPRDLVDEILEELEHSV
PLLEVYPVEGQDTDIHVIALALEVVRFFYDFLWRDWDDEESCENYTALIEERINLWCDIQ
DGTIPGPIAQRFKKTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCGLLK
MWEDLRLRVHGPFFPRILRRRKGKREFGKTITHIVAKMMTTEMIKDLSSDTLLQQHDDLD
LALDNCYSGDTVIIFPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADN
VKLMHLSLIQQGTVDGIVVVESGHMTLENCVLKCEGTGVCVLTGAALTITDSEITGAQGA
GVELYPGSIAILERNEIHHCNNLRTSDSSKSTLGGVNMKVLPAPKLKMTNNHIYSNKGYG
VSILQPTEQFFIIAEEALNKRASSGDKKDDKMLFKVMQNLNLEMNNNKIEANVKGDIRIV
TS
Download sequence
Identical sequences ENSGGOP00000003427 ENSGGOP00000017425 ENSGGOP00000003427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]