SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017451 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017451
Domain Number 1 Region: 356-668
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.92e-54
Family Integrin alpha N-terminal domain 0.0000521
Further Details:      
 
Domain Number 2 Region: 189-378
Classification Level Classification E-value
Superfamily vWA-like 1.34e-42
Family Integrin A (or I) domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 818-950
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-28
Family Integrin domains 0.0053
Further Details:      
 
Domain Number 4 Region: 668-814
Classification Level Classification E-value
Superfamily Integrin domains 0.00000183
Family Integrin domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017451   Gene: ENSGGOG00000007471   Transcript: ENSGGOT00000028791
Sequence length 1169
Comment pep:known_by_projection chromosome:gorGor3.1:17:3738922:3803538:-1 gene:ENSGGOG00000007471 transcript:ENSGGOT00000028791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPLSLNAPLFPAGLASLSAFNVDVARPWLTPRGGAPFVLSSLLHQDPSTNQTWLLVTSPR
TKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLN
SELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARWRRA
RETKASLLPGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECNFALVQYGGVI
QTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSRRKASKVMVVL
TDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTERELNLIASDPDETHAFKVT
NYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGAVGAFDWSGGA
LLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYVAGAPRYKHHGAVF
ELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYHVHGEEGRVYV
YRLSEQDGSFSLVRILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAPLEGFGADDGA
SFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGLADITVGTLGQ
AVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGLRGALLNFTLD
VDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEAELCEEDCFSNASVKVSYQ
LQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTK
ELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVASVLIMNCRIG
HPVLKRSSAHVSVIWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQFRHGFVAVLS
KPSIMYVNTGQGLSHHKEFLFHIHGENLFGVEYQLQICVPTKLRGLQVVAVKKLTRTQAS
TVCTWSQQRACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISLDHSEELLKDVTELQIL
GEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLIVILVILFKCG
FFKRKYQQLNLESIRKAQLKSENLLEEEN
Download sequence
Identical sequences ENSGGOP00000017451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]