SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017490
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily DNA clamp 2.86e-37
Family DNA polymerase processivity factor 0.00000176
Further Details:      
 
Domain Number 2 Region: 128-249
Classification Level Classification E-value
Superfamily DNA clamp 1.18e-25
Family DNA polymerase processivity factor 0.00000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017490   Gene: ENSGGOG00000024269   Transcript: ENSGGOT00000033212
Sequence length 255
Comment pep:novel chromosome:gorGor3.1:X:46796964:46797747:-1 gene:ENSGGOG00000024269 transcript:ENSGGOT00000033212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKAPLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHFSLVQFTLPSEGFDTY
RCDCNLAMGVNLTIMSKILKCAGNEDIVKLRIEDDVNTLVLVFEASNQEKFSDYEIKLMD
LDVEQVGIAEQEYHYVVKMLSGEFANLSHIGDAVVISGVKDGYFLQVETLEMENKLSQTS
TVDKEEEAVTMEMNEPVQRTFALRYLNFLTKATPLSSMVTLNISADIHLVVDYKIADMGH
LKYYLAPKIEDEEGP
Download sequence
Identical sequences ENSGGOP00000017490 ENSGGOP00000017490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]