SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017504 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017504
Domain Number 1 Region: 480-503,692-793,925-980
Classification Level Classification E-value
Superfamily HAD-like 2.21e-23
Family Meta-cation ATPase, catalytic domain P 0.028
Further Details:      
 
Domain Number 2 Region: 497-527,557-758
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.85e-22
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0082
Further Details:      
 
Domain Number 3 Region: 130-220,363-485,1013-1191
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-18
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 
Domain Number 4 Region: 251-287,323-356
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000706
Family Calcium ATPase, transduction domain A 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017504   Gene: ENSGGOG00000008991   Transcript: ENSGGOT00000022511
Sequence length 1313
Comment pep:known_by_projection chromosome:gorGor3.1:19:1782836:1814394:-1 gene:ENSGGOG00000008991 transcript:ENSGGOT00000022511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGPAQTPRSTRAGPEPSPAPPGPGDTGDSDVTQEGSGPAGIRGGETVIRAGMGDSPGR
GAPERRHKAQPGRARKYEWRPEGPTSMGSLGQREDLQDEDRNSAFTWKVQANNRAYNRQF
KEKVILCWQRKKYKTNVIRTAKYSFFSFLPLNLYEQFHRVSNLFFLLIIILQSIPDISTL
PWFSLSTPMVCLLFIRATRDLVDDMGRHKSDRAINNRPCQILMGKRVGRAAAPPICLASP
LATLPPTPPQADMLLLASTEPSSLCYVETVDIDGETNLKFRQALMVTHKELATIKKMASF
QGTVTCEAPNSRMHHFVGCLEWNDKKYSLDIGNLLLRGCRIRNTDTCYGLVIYAGTAAPG
SWSGSCTDGSVVDGCGDGWVVFIFISVVLVCLVLAFGFGFSVKELKDHHYYLSGVRGSSV
AAESFFVFWSFLILLSVTIPMSMFILSEFIYLGNSVFIDWDVQMYYKPQDVPAKARSTSL
NDHLGQVEYIFSDKTGTLTQNILTFNKCCINGRVYGPDSETTTRPKENPYLWNKFADGKL
LFHNAALLHLVRTNRDEAVREFWRLLAICHTVMVRESHRECPDQLLYQAASPDEGALVTA
ARNFGYVFLSRTQDTITIMELGEERVYQVLAIMDFNSMRKRMSVLVRKPEGTICLYTKGA
DTVIFERLHRRGAVEFATEEALAAFAQETLRTLCLAYREVAEDIYEDWQQRHQEASLLLQ
NRAQALQQQALQQVYNEMEQNLRLLGATAIEDRLQDGVPETIKCLKKSNIKIWVLTGDKQ
VLASDTSLGSPVLARSPAPLTPAPRSRILETYWENSNNLLTRESLSQVKLALVINGDFLD
KLLVSLRKEPRALVQNVNMDEAWQEPGQSRRDFLYARRLSLLCRRFGLPLAAPPAQDSRA
RRSSSEVLQERAFVDLASKCQAVICCRVTPKQKALIVALVKKYHQVVTLAIGDGANDINM
IKTAPPGIPVWGGQGWDLCRGTEAWKRLAVVLQKLHGGLQFAMQIFPHYRSSGRRALASM
LLGIMGVHRAAVSPKQTWPARGGPDLCWGSPAPHPIPRASACPKDVSAEQSLEKPELYVV
GQKDELFNYWVFVQAIAHGVITSLVNFFMTLWISRDTAGPASFSDHQSFAVVVALSCLLS
ITMEVILIIKYWTALCVATILLSLGFYAIMTTTTQSFWLFRVSPKTFPFLYADLSVVSSP
SILLVVLLSVSINTFPVLALRVIFPALKELRAKEEKVEEGPSEEIFTMEPLPHVHRESRA
RRSSYAFSHREGYANLITQGTILRRGPGVSSDIASESLDPSDEEAASSPKESH
Download sequence
Identical sequences ENSGGOP00000008798 ENSGGOP00000017504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]