SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017545 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017545
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-20
Family PDZ domain 0.0000791
Further Details:      
 
Domain Number 2 Region: 446-510
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.61e-18
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 387-449
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.46e-16
Family LIM domain 0.0018
Further Details:      
 
Domain Number 4 Region: 354-385
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000172
Family LIM domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017545
Domain Number - Region: 505-533
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00143
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017545   Gene: ENSGGOG00000024845   Transcript: ENSGGOT00000025421
Sequence length 537
Comment pep:known_by_projection chromosome:gorGor3.1:4:103523368:103734321:1 gene:ENSGGOG00000024845 transcript:ENSGGOT00000025421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQG
MTHLEAQNKIKGCTGSLNMTLQRASATPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTST
NNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLH
ANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQGDSKQQNKESE
ADNTKKANNSQEPSPQLASSVTSTRSMPESLDSPASGRPGVTSLTTAAAFKPVGSTGVIK
SPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPM
CAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPEC
GRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNDVFHLEDGEPYCETDYYALFGTICH
GCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF
Download sequence
Identical sequences ENSGGOP00000017545 ENSGGOP00000017545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]