SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017610 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017610
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-22
Family SH2 domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017610   Gene: ENSGGOG00000006844   Transcript: ENSGGOT00000026416
Sequence length 429
Comment pep:known_by_projection chromosome:gorGor3.1:4:10269996:10474394:-1 gene:ENSGGOG00000006844 transcript:ENSGGOT00000026416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQGNRRTTKEGSNDLKFQNFSLPKNRSWPHINSATGQYQRMNKPLLDWERNFAAVLDG
TKGHSDDDYDDPELRKEETWQPIKILPARPIKESEYADTRYFKVAMDTPLPLDTRTSIST
GQQTWNTQTRLERVDKPISKDIRSQNIKGDTSVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFSEAQRMPSQISLRDLSEIMSLFYIVPYNQRKPESTHLLQNQNTQEIP
LAISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSGRPPFPKRS
DRKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLVVFNENKVYNV
KIRFLERSQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPL
PLTRHLLPL
Download sequence
Identical sequences ENSGGOP00000006701 ENSGGOP00000017610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]