SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017614 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017614
Domain Number 1 Region: 199-348
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.02e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017614   Gene: ENSGGOG00000014757   Transcript: ENSGGOT00000028705
Sequence length 1027
Comment pep:known_by_projection chromosome:gorGor3.1:10:14044848:14260272:-1 gene:ENSGGOG00000014757 transcript:ENSGGOT00000028705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDS
EVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIF
QWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQ
ESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEP
PIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQ
RKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDED
SQVTSTISPLHSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESS
LDEPYEKVKKRSSHSHSSSHKRFPSTGSCAEAGGGSNSLQNSPIRGLPHWNSQSSMPSTP
DLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRT
RSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGS
ASSGSMPNLAARGGAGGAGGAXXXGGGVYLHSQSQPSSQYRIKEYPLYIEGGATPVVVRS
LESDQEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTSRLTPSRSQILRTPSLGRE
GAHDKGAGRTAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSR
VTRMPQMCKATSAALPQSQRSSTPSSEIGATPPSSPHHILTWQTGEATENSPILDGSESP
PHQSTDE
Download sequence
Identical sequences ENSGGOP00000017614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]