SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017634 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017634
Domain Number 1 Region: 66-233
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-41
Family C-type lectin domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017634   Gene: ENSGGOG00000022730   Transcript: ENSGGOT00000029937
Sequence length 237
Comment pep:known_by_projection chromosome:gorGor3.1:12:8342803:8357781:1 gene:ENSGGOG00000022730 transcript:ENSGGOT00000029937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEITYAEVRFKNEFKSSGINTASSAASNERTAPHKSNTGFPKLLCASLLIFFLLLAIS
FFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFI
STESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVD
QTPYNESSTFWHPREPSDPNERCVVLNFRKAPKRWGWNDVNCLGPQRSVCEMLKIHL
Download sequence
Identical sequences A0A2I2ZY63
ENSGGOP00000017634 ENSGGOP00000017634 XP_004052692.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]