SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017671 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017671
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.96e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 2 Region: 312-490
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.89e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017671   Gene: ENSGGOG00000025654   Transcript: ENSGGOT00000026374
Sequence length 538
Comment pep:known_by_projection chromosome:gorGor3.1:1:150342937:150366067:1 gene:ENSGGOG00000025654 transcript:ENSGGOT00000026374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRVGIIGAGVSGLAAIRCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFT
NSSKEMMCFPDFPYLDDYPKYMHHSKLQEYIKTYAQKKDLLRYIQFETLVSSIKKCPSFL
VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPE
AFKGKRVLVIGLGNLGSDIAVELSCLATQVIISTRSGSWVMSRVWDDGYPWDMMYVTRFA
SFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRKEPVFNDELPSRILCGTLSIK
PSVKEFTETSAVFEDGTVFEAIDSVIFATGYDYSYPFLDETIMKSRNNEVTLFKGIFPPL
MEKPTLAVIGLVQSLGAAIPTADLQARWAAKVFANSCTLPTTNEMMDDIDEKMGKKLKCM
FSSFFRFGQSTLQTDYITYMDELGSFIGAKPNIPWLFLTDPHLALEVYFGSCSPYQFRLM
GPGKWDGARNAILTQWNRTVKPTRTRVVSEAKRPHPFYNLPKMLSFPLLLLAVTLTFY
Download sequence
Identical sequences ENSGGOP00000017671 ENSGGOP00000017671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]