SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017684 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017684
Domain Number 1 Region: 690-881
Classification Level Classification E-value
Superfamily HAD-like 1.65e-34
Family Meta-cation ATPase, catalytic domain P 0.05
Further Details:      
 
Domain Number 2 Region: 87-178,325-417,882-1099
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.49e-34
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 3 Region: 185-245,284-319
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.68e-18
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 4 Region: 433-465,500-703
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000000000000414
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017684   Gene: ENSGGOG00000008135   Transcript: ENSGGOT00000026812
Sequence length 1108
Comment pep:known_by_projection chromosome:gorGor3.1:18:77597160:77884234:1 gene:ENSGGOG00000008135 transcript:ENSGGOT00000026812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSC
CGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLN
LYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKL
TVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKV
AVSCTQRLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWAST
IVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQ
GFVGPWYRSLFRFLLLFSYIIPIRLRFDIQLSKNVYIFVLLYKKDVPKSMISTSTIPTEV
FLVIYLLFNETRTLTQNEMIFKRLHLGTVSYGADMMDEIQSHVRDSYSQMQSQAGGNNTG
STPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTGETEFAEADQDFSD
ENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKR
MGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQ
YQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAG
IKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVIS
GDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKACIVTLLQQHTGRRTCAIGDGGNDV
SMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRG
LIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELY
KDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVA
LTVRTWHWLMVVAEFLSLGCYVSSLAFLSEYFGIGRVSFGAFLDVAFITTVTFLWKVSAI
TVVSCLPLYVLKYLRRKLSPPSYCKLAS
Download sequence
Identical sequences ENSGGOP00000017684 ENSGGOP00000017684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]