SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000017693
Domain Number - Region: 57-202
Classification Level Classification E-value
Superfamily SNF-like 0.0484
Family SNF-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017693   Gene: ENSGGOG00000028221   Transcript: ENSGGOT00000026151
Sequence length 261
Comment pep:novel chromosome:gorGor3.1:4:155564869:155565762:1 gene:ENSGGOG00000028221 transcript:ENSGGOT00000026151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSVATQSPSIPSSSSGAETSTPGSSGSPGACPALGTKSCSSSCAVHDLIFWRDVKKT
GFVFATMLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYL
DVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNG
ITLLILAELLIFSVPIVYEKYKTQTDHYIGIARDQTMSIVEKIQAKLPGIAKKKGRISTW
KPEMQQLLKHHLIIITSLLVL
Download sequence
Identical sequences ENSGGOP00000017693 ENSGGOP00000017693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]