SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017722
Domain Number 1 Region: 194-264
Classification Level Classification E-value
Superfamily EF-hand 0.0000193
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017722   Gene: ENSGGOG00000026446   Transcript: ENSGGOT00000032793
Sequence length 572
Comment pep:known_by_projection chromosome:gorGor3.1:3:129338944:129366458:-1 gene:ENSGGOG00000026446 transcript:ENSGGOT00000032793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPELVIAHCFKQFQQKDFRLPQTRRRII
MVPRKEDQTPINPASQPQAPPKPIPSFKALEARDIQEQPEDRKTWLSQRSKLRQELESFG
DVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATNRTTRKKAPRLSRLSRQMVPQLQ
LPEPPALSVMYSYLHSRKIKILEIFHKVGQGENQRITREEFIAAIKAVGVPLKNQEVEDI
VIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATARERYILAKHRDSLKGPLKKQEVD
SAPQLPKVDLLTVPAIDTQMEARPMTLEEMEEVGKWYCERQRQHKLMIPSIQYTEQCHLV
RCGNRHFDEHCLPSTIHGDMRELIESARRHNFLVYLQCWKLCESYGLPLTEDILMKALLY
PGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFK
EFEEFTRKLKVKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSCVQHQPHVY
PATYHPDHWWPLRNKNYMTRAHYDAAKVYYIN
Download sequence
Identical sequences G3RPK2
ENSGGOP00000017722 XP_004036330.1.27298 ENSGGOP00000017722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]