SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017723 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017723
Domain Number 1 Region: 2806-2981
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.27e-32
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2636-2799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2238-2409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 2408-2577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.26e-19
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 5 Region: 2038-2234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000443
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 1005-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1336-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 8 Region: 185-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 915-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000314
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 1388-1438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000452
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 11 Region: 140-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 3-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 280-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 1054-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 73-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 16 Region: 333-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000829
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017723
Domain Number - Region: 235-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000276
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 967-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family Laminin-type module 0.049
Further Details:      
 
Domain Number - Region: 1301-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.051
Further Details:      
 
Domain Number - Region: 1749-1968
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 
Domain Number - Region: 1507-1643
Classification Level Classification E-value
Superfamily Tropomyosin 0.0536
Family Tropomyosin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017723   Gene: ENSGGOG00000006722   Transcript: ENSGGOT00000025774
Sequence length 2982
Comment pep:known_by_projection chromosome:gorGor3.1:18:20732595:20964512:1 gene:ENSGGOG00000006722 transcript:ENSGGOT00000025774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SACNCHGHASDCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPY
GVPVDAPDGCIPCSCDPEHADGCEQGSGRCHCKSNFHGDNCEKCAIGYYNFPFCLRIPIF
PVSTPSSEDPVAGDIKGKWCDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFP
ICQACWCSALGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGT
INSNLGYCQCKLHVEGPTCSSCKLLYWNLDKENPSGCSECQCHKAGTVSGTGECRQGDGD
CQCKSHVGGDSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSVCSGPSGVCQCREHVVG
KVCQRPENNYYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDV
RITLNVGKSSGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVP
GNGFADPFSITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENC
LLYQHLPVTRFPCTLACEARHFLLDGEPRSVAVRQPTPAHPVMVDLSGREVELHLRLRVP
QVGHYVVVVEYSTEAAQLFVVDVNVKSPGSVLAGQVNIYSCNYSVLCRSAVIDHMSRIAM
YELLADADIQLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGRFVNQSATCVSLA
HETPPTALILDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVI
HFYQAAHPTFPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIEFDISEPEVAATV
KIPEGKSLVLVRVLAVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNS
ARSLVAFYHKGALPCECHPTGATGPHCSPEGGQCPCRPNIIGRQCTRCATGHYGFPRCKP
CSCGRRLCEEMTGQCHCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPEC
DRDSGQCRCKPRITGRRCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVE
GTECNVCREGSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDI
PVSFNPGSNSMVADLQELPATVHSASWVAPTSYLGDKVSSYGGYLTYQAKSFGLPGDMVL
LEKKPDVQLTGQHMSIIYEETNTPRPDRLHHGRVQVVEGNFRHASSRAPVSREELMTVLS
RLADVRIQGLYFTETQRLTLSEVGLEEASDTGSGRIALAVEICTCPPAYAGDSCQGCSPG
YYRDHKGLYTGQCVPCNCNGHSNRCQDGSGICVNCQHNTEGEHCERCQEGYYGNAVHGSC
RACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNS
NGQLGSCHPLTGDCMNQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLS
ASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKAQV
NSRKAQTLYNNVNQATQSAKELDVKIKNVIRNVHVLLKQISGTDGEGNNVPSGDFSREWA
EAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEY
EAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSL
LQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSLQE
LAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKED
LPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTLRD
GLRGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFKKA
LTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPM
RFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGM
AVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATSSK
PETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNENV
LSLYNFKNTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTTVD
RGLLFFAENGDRFISLNIEDGKLMVRYKLNSEPPKERGVGDAINNGRDHSIQIKIGKLQK
RMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLN
DTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQT
WTRNLQVTLEDGYIELSTSDSSGPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQPLRN
NKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNK
PPFLMLLKGSTRFNKTKTFRINQLLQDTPMASPRSMKVWQDACSPLPKTQANHGALQFGD
IPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTD
GKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSP
PSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGVYFSEEGGHVVLA
HSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVT
PKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTL
RIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDH
Download sequence
Identical sequences ENSGGOP00000017723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]