SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017724 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017724
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily EF-hand 6.68e-56
Family Calmodulin-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017724   Gene: ENSGGOG00000002521   Transcript: ENSGGOT00000029874
Sequence length 149
Comment pep:known_by_projection chromosome:gorGor3.1:2a:47968848:47971465:-1 gene:ENSGGOG00000002521 transcript:ENSGGOT00000029874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIFGLWSSFQTEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
Download sequence
Identical sequences ENSGGOP00000017724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]