SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017736
Domain Number 1 Region: 1571-1813
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 507-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000456
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 3 Region: 468-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 582-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000792
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 544-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000829
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 6 Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 348-473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 763-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 923-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 187-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000456
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 151-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 673-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000377
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 13 Region: 1042-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 229-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.025
Further Details:      
 
Domain Number 15 Region: 1248-1279
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 16 Region: 893-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 836-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000602
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 307-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 804-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family EGF-type module 0.018
Further Details:      
 
Domain Number 20 Region: 24-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000668
Family EGF-type module 0.024
Further Details:      
 
Domain Number 21 Region: 59-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000709
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1211-1241
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 23 Region: 113-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017736
Domain Number - Region: 1084-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00273
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1170-1199
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1129-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 619-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017736   Gene: ENSGGOG00000002332   Transcript: ENSGGOT00000024098
Sequence length 1995
Comment pep:known_by_projection chromosome:gorGor3.1:6:33082834:33112065:-1 gene:ENSGGOG00000002332 transcript:ENSGGOT00000024098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQRRWLLPQCVSVVIPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGEKCQFPDP
CQNAQLCQNGGSCQALLPTPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFC
SKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCHCPPGFE
GHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPPRGCSNGG
TCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWT
GWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPG
STCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGP
TCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPG
STCLDLLATFHCLCPPGLEGQLCEVVTNECASAPCLNHADCHDLLNGFQCICLPGFSGTR
CEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPAGASCLDL
PGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTC
HHGHCQRTRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPT
CSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNR
PGTFSCLCAMGFQGPRCEGKIRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLM
DLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGG
LCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNC
SKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHS
LANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCS
HRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGS
CSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSL
GVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHN
GHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRV
GLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQMQPLGKETDSLSAGFVVVM
GVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPANQL
PWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRQPRTQSAPHRRRPPLG
EDSIGLKALKPKAEVDEDGVVMCSGPEEGEEAEETGPPSTCQLWSLSGGCGALPQAAMLT
PPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLLDGGACPQA
HTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLR
SRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNAR
AARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVAH
QRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTASVSVPPHGGGALPRCRTLSAGA
GPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPPPRGRRFSAGMRGPRPNPA
IMRGRYGAAAGRGGRVSTDDWPCDWVALEACGSASNIPIPPPCLTPSPERGSPQLDCGPP
ALQEMPINQGGEGKK
Download sequence
Identical sequences ENSGGOP00000017736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]