SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017744 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017744
Domain Number 1 Region: 117-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-57
Family SPRY domain 0.000001
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000353
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017744   Gene: ENSGGOG00000011393   Transcript: ENSGGOT00000031612
Sequence length 317
Comment pep:novel chromosome:gorGor3.1:22:16378132:16381618:-1 gene:ENSGGOG00000011393 transcript:ENSGGOT00000031612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYPEKPMSLECGCAVC
LKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLASHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLGSVRSGLITQNRQHLAERFDVSVCVLGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHRKGKIQLTTELGFWTVSLRDGGRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAKSGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
LMNSGTTDAPVRPGEAK
Download sequence
Identical sequences ENSGGOP00000017744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]