SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017755 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017755
Domain Number 1 Region: 160-443
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 4.45e-101
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000000255
Further Details:      
 
Domain Number 2 Region: 2-121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-24
Family G proteins 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017755   Gene: ENSGGOG00000015555   Transcript: ENSGGOT00000033462
Sequence length 454
Comment pep:known_by_projection chromosome:gorGor3.1:1:91826261:91832329:1 gene:ENSGGOG00000015555 transcript:ENSGGOT00000033462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFSLGSTVQSHTKGIWMWCMPHSKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLS
STSMYNSMGTINQQAMDQLHYVTELTHRVQPKSSPDENENEDSADFASFFPDFVSTLRDF
QITESPFGQNCDKINNLVQLGIETFFTTRNISICSPYAGLESLVLTYVNAISSGDLPCME
NAVLALAQIENSAAVQKAIARYEQQMGQKVQLPTETLQELLDLHRDSEREATEVFIRSSF
KDVDHLFQKELAAQLDKKRDDFCKQNQEASSDRSSALLQVIFSPLEEEVKAGIYSKPGGY
RLFIQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKQKEIEVER
VKAESAQASQMQRKNEQMMEQKERSYQEHLKQLTEKMERDRAQFLEEEERTLALKLQEQQ
QLLKERFENVSRRIQNEIQNLPRTMIQPRTCTIN
Download sequence
Identical sequences ENSGGOP00000017755 ENSGGOP00000017755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]