SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017757 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017757
Domain Number 1 Region: 635-673
Classification Level Classification E-value
Superfamily SAP domain 0.000000256
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 897-941
Classification Level Classification E-value
Superfamily EF-hand 0.0000277
Family Calmodulin-like 0.064
Further Details:      
 
Domain Number 3 Region: 146-207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000437
Family Cold shock DNA-binding domain-like 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017757
Domain Number - Region: 1009-1098
Classification Level Classification E-value
Superfamily Tropomyosin 0.00209
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017757   Gene: ENSGGOG00000002776   Transcript: ENSGGOT00000028078
Sequence length 1123
Comment pep:known_by_projection chromosome:gorGor3.1:10:81181272:81252302:1 gene:ENSGGOG00000002776 transcript:ENSGGOT00000028078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
RYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
QLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDDKEEEERKRQEEIERQRRERR
YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
DFGVRIYKSLLSLPTDEPKPKRRKSGDDKDKKEDRDERKKEDKRKDDSKDDDETEEDNNQ
DEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLM
AFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKLTDTSKDEE
NHEESESLQEDMLGNRLLLPTPTVKQESKDVEENVGLIVYNGAMVDVGSLLQKLEKSEKV
RAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNSQF
ENQLNKTIRNLSTVMDEIHTVLKKDNVKNEDKDQKSKENGANV
Download sequence
Identical sequences ENSGGOP00000017757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]