SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017771 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017771
Domain Number 1 Region: 586-767
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.13e-64
Family SPRY domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 6.47e-24
Family Pyrin domain, PYD 0.0035
Further Details:      
 
Domain Number 3 Region: 358-423
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017771   Gene: ENSGGOG00000015800   Transcript: ENSGGOT00000031528
Sequence length 773
Comment pep:known_by_projection chromosome:gorGor3.1:16:3429168:3443109:-1 gene:ENSGGOG00000015800 transcript:ENSGGOT00000031528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGKEGNGPRPYGGGAASLRCSQPEAGRGLSRKLLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRAPERDQAEVRLRRNASSAGRLQGKECRPFEVYLPSGKMRPRSLEVTIS
TGEKAPANPEILLTLEETTAANLDSATEPRARPTPDGGASADLKEGPGNPEHLFTGRPPD
TAASPHCHAQEGDPVGGTCEHDSCSCPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLS
PQPLPQCKRHMKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHKKKIQKQLE
HLKKLRKSGEEQRSYGEEKAVSFLKQTEVLKQRVQRKLEQVYYFLEQQEHFFVASLEDVG
QMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKTVPVPEHWT
TPQEIKQKIQLLHRKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNVILDAETAY
PNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVGDKTAWILG
ACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGIFVDYRVGS
ISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGPD
Download sequence
Identical sequences ENSGGOP00000017771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]