SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017778 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017778
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily SRP19 4.32e-28
Family SRP19 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017778   Gene: ENSGGOG00000023332   Transcript: ENSGGOT00000022458
Sequence length 137
Comment pep:novel chromosome:gorGor3.1:18:57206493:57206970:-1 gene:ENSGGOG00000023332 transcript:ENSGGOT00000022458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACTAVRFPAKQDRFICIYPAFLNNKKTIAEGRRIPISKAVENPTATEIQDVCSEVGLNVF
LEKKEWNRDVQYRGLKRVQLKQEDGSLCLVQFPSCKSVMLYAAEIIPKLKRRTQKTGGGD
QSLQQGEGSKKGKGKKK
Download sequence
Identical sequences ENSGGOP00000017778 ENSGGOP00000017921 ENSGGOP00000017778 ENSGGOP00000017921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]