SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017818
Domain Number 1 Region: 1377-1848
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.75e-162
Family Family 1 of glycosyl hydrolase 0.0000000143
Further Details:      
 
Domain Number 2 Region: 903-1364
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.35e-159
Family Family 1 of glycosyl hydrolase 0.00000000424
Further Details:      
 
Domain Number 3 Region: 375-844
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.62e-144
Family Family 1 of glycosyl hydrolase 0.0000000512
Further Details:      
 
Domain Number 4 Region: 34-216
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.05e-30
Family Family 1 of glycosyl hydrolase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017818   Gene: ENSGGOG00000002058   Transcript: ENSGGOT00000032346
Sequence length 1928
Comment pep:known_by_projection chromosome:gorGor3.1:2b:22888310:22939353:-1 gene:ENSGGOG00000002058 transcript:ENSGGOT00000032346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKD
MYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLEAL
KTARLQPMVILHHQTLPASTLQRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASQLQTLSDAHRKAYEIYHENYASQVGLLKTGREHRDQDLMWWDPPGPAQAS
QDAVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNQASLLFS
LFEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPDQQQDHETTDSSPASAY
QRVWEAFANQSRVERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGASIWDPCRPLNT
TEGQATPEVASDSYHKVASDVALLRGLRAQVYKFSISWSRIFPMGHGSSPSLPGVAYYNK
LIDRLQDAGIEPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVT
FHEPWVMSYAGYGTGQHPPGISDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGI
VLNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPIFVDGDYPATLRTQIQQMNGQCSHP
VAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYDTIGGFSQHVNHVWPQ
TSSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSLRVDYFNQYI
NEVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFT
SIIEKNGFLTKGAKRLLPPNMANLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFY
HGTFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQL
DADLNMLRALKVKAYRFSISWSRIFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLF
HWDLPQALQDIGGWENPALIDLFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEF
PPGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPKSPGVPRD
VEAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFTEEEKRFIRA
TADVFCLNTYYSRIVQHKTPRLNPPSYEDDREMAEEEDPSWPSTAMNRAAPWGTRRLLNW
IKEEYGDIPIYITENGVGLTDPNTEDTDRIFYHKTYINEALKAYRLDGVDLRGYVAWSLM
DNFEWLNGYTVKFGLYHVDFNNMNRPRTARASARYYTEVITNNGMPLAREDEFLYGRFPE
GFIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLKVEDDAIGDVACDSYHKIAEDLVTL
QNLGVSHYRFSISWSRILPDGTTRYINEAGLNYYVRLIDTLLAASIQPQVTIYHWDLPQT
LQDVGGWENETIVQRFKEYADVLFRRLGDKVKFWITLNEPFVIAYQGYGYGTAAPGISNR
PGTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARR
YVQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFG
FNHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSLWLKMTPFGFRRILNWLKEE
YNDPPIYVTENGVSQREETDLNDTARIYYLRAYINEALKAVQDKVDLRGYTVWSAMDNFE
WATGFSERFGLHFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPT
ISPVRQEEVQFLGLMLGTAEAQTALYVLFSLVLLGVCGLAFLSYKYCKGSKQGKTQRSQQ
ELSPVSSF
Download sequence
Identical sequences ENSGGOP00000002030 ENSGGOP00000017818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]