SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017822 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017822
Domain Number 1 Region: 255-441
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.59e-56
Family Reprolysin-like 0.00017
Further Details:      
 
Domain Number 2 Region: 466-541
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.46e-23
Family Blood coagulation inhibitor (disintegrin) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017822   Gene: ENSGGOG00000023185   Transcript: ENSGGOT00000022870
Sequence length 776
Comment pep:known_by_projection chromosome:gorGor3.1:14:51698929:51711580:-1 gene:ENSGGOG00000023185 transcript:ENSGGOT00000022870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLHQDTDPQIPKGQPCTLNSSEGGARPAVPHTLFSSALDRWLHNDSFIMAVGEPLVHI
RVTLLLLWFGMFLSISGHSQARPSQYFTSPEVVIPLKVISRGRGAKAPGWLSYSLRFGGQ
RYIVHMRVNKLLFAAHLPVFTYTEQHALLQDQPFIQDDCYYHGYVEGVPESLVALSTCSG
GFLGMLQINDLVYEIKPISVSATFEHLVYKIDSDDTQFPPMRCGLTEEKIAHQMELQLSY
NFTLKQSSFVGWWTHQRFVELVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSLYHPLEI
HVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKLGV
AYVKGICQNPFNTGVDVFEDNRLVIFAVTLGHELGHNLGMQHDTQWCVCELQWCIMHAYR
KVTTKFSNCSYAQYWDSTISSGLCIQPPPYPGNIFRLKYCGNLVVEEGEECDCGTIQQCA
KDPCCLLNCTLRPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVY
VQDGISCNVNAFCYEKMCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIEGTT
YVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKD
GTVCGPEKICIRKKCASMVHLSQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGG
SADSGPPPKNNMEGLNVMGKLRYLSLLCLLPLVAFLLFCLHVLFKKRTKSKEDEEG
Download sequence
Identical sequences ENSGGOP00000017822 ENSGGOP00000017822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]