SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017845 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017845
Domain Number 1 Region: 214-291
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000011
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017845   Gene: ENSGGOG00000025870   Transcript: ENSGGOT00000023236
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:20:61235635:61236753:-1 gene:ENSGGOG00000025870 transcript:ENSGGOT00000023236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPDRAAPAAPRRPSVAPTPGLACGAGGARLQKEELTRSPLIGQARSHRAPPGLKPGGEG
EVEPLPSRLGGRGGGREGRGGGGSAPRLWDPQASQTDAQSRDPHRSGRRAWAGLGRPPGE
PPSPGGAAMAESRGDAYLALSHGYGGGCGSRLRGGARTRSGPRGAPGPGGDLPGACTSRP
SSGGSSGEQSGDEDDGSGGGAGGSGGGGGGREQRSLRLSINARERRRMHDLNDALDGLRA
VIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQAAAPVTAAPLTPF
GQATVCPFPAGPRWPCPDKCAAFSGTPSALCKHCHEKP
Download sequence
Identical sequences ENSGGOP00000017845 ENSGGOP00000017845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]