SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017875 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017875
Domain Number 1 Region: 2602-2782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 1905-2016
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 2009-2114
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-29
Family Cadherin 0.00087
Further Details:      
 
Domain Number 4 Region: 2115-2226
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-28
Family Cadherin 0.00056
Further Details:      
 
Domain Number 5 Region: 1588-1696
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 334-447
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 1060-1166
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.00063
Further Details:      
 
Domain Number 8 Region: 543-663
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 1803-1911
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 1368-1505
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-24
Family Cadherin 0.0034
Further Details:      
 
Domain Number 11 Region: 234-338
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-23
Family Cadherin 0.00087
Further Details:      
 
Domain Number 12 Region: 852-959
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.0032
Further Details:      
 
Domain Number 13 Region: 1697-1801
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 14 Region: 446-549
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 1270-1380
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-21
Family Cadherin 0.0035
Further Details:      
 
Domain Number 16 Region: 2214-2332
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 17 Region: 1167-1267
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 18 Region: 22-136
Classification Level Classification E-value
Superfamily Cadherin-like 2.9e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 19 Region: 960-1067
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 651-774
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 21 Region: 760-864
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000106
Family Cadherin 0.0026
Further Details:      
 
Domain Number 22 Region: 141-240
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000106
Family Cadherin 0.013
Further Details:      
 
Domain Number 23 Region: 1485-1594
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0044
Further Details:      
 
Domain Number 24 Region: 2327-2417
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.0046
Further Details:      
 
Domain Number 25 Region: 2874-2915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000473
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 2840-2882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.02
Further Details:      
 
Domain Number 27 Region: 2803-2841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000495
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017875   Gene: ENSGGOG00000017065   Transcript: ENSGGOT00000026828
Sequence length 3372
Comment pep:known_by_projection chromosome:gorGor3.1:11:90059125:90190569:1 gene:ENSGGOG00000017065 transcript:ENSGGOT00000026828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQVTVTDGGPAPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFA
FDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQKS
STARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGG
NFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEF
SQPNYDVTISEDVLPDTEILQFEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYT
AERLDHEAQDKHILNIMVRDQEFPYRRNLARVVVNVEDANDHSPYFTNPLYEASVFESAA
LGSAVLQVTALDKDKGENAELIYTIEAGNTGNTFKIEPVLGIITICKEPDMTTMGQFVLS
IKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQST
LIYEVKDGDINGIFTINPYSGVITTRKALDYERTSSYQLIIQATNMAGMASNATVNIQIV
DENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTA
KKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNP
PVFTQAVFETILLLPTYVGVEVLKVGATDPDSEVPPELTYSLIEGSLDHFLIDSNSGVLT
IKNNSLSKDHYMLIVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITK
VAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASREL
DHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVT
YVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVN
KAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVL
KVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEAS
LIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHC
TLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASD
ADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLFTSTA
QVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFA
KDRFLIDSNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQF
MTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWM
VTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAED
TAIGSTVDTLRILPSQNVRFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDHETSPAFH
FKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAID
MDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGE
AFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQV
SYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVS
DVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGDIRYSLYGSGNSEFFLDP
ESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCV
YENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSS
YNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFA
TSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPA
LSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSI
VNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQALDSGIPAMSSTATVNIDISDVN
DNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPH
GILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVT
MEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKYVLNV
SVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRTLRNAVLTQ
KQDSLRIISIQPVAGTNQLDMLFAVEMHSSEFYKPAYLIQKLSNARRHLENIMRISAILE
KNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLCPGSNDPCV
EKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKEEDFK
LALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGILGISGRAVNDGSWHSV
FLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQADNIRSLTDTRVTQVLS
GFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQHGGSCTGLP
SGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTGVMCEEDIN
ECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGKEELIGIAV
VLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSNGIPFRNLRGSGDGRN
VYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTTFHPESPRILTARRGV
VVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKGVDDPGEVTCFAGSNKGSNSEVQSLS
SFQSDSGDDNGPQASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWMPGARL
SDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPLPE
DFPDQYEALPPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGPPASCEFSTF
AVGMNQGTEPTGPADSVSLSLHNSRGTSSSDVSANCGFDDSEVAMSDYESVGELSLASLH
IPFVETQHQTQV
Download sequence
Identical sequences ENSGGOP00000017875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]