SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017898 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017898
Domain Number 1 Region: 317-498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-62
Family SPRY domain 0.000021
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-16
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 3 Region: 111-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000641
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017898   Gene: ENSGGOG00000026083   Transcript: ENSGGOT00000026916
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:15:23488887:23522030:1 gene:ENSGGOG00000026083 transcript:ENSGGOT00000026916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSTNPSSNIDPGDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNF
CQACIQDFWRLQAKETFCPECKMLCQYSNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGE
NLKLFSKPDGKLICFQCKDARLSVGQSKEFLQISDAVHFFTEELAIQQSQLETTLKELQT
LRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELWEEGKALNEEMELNL
SQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMRVLATRELIYRKLNLG
QYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSESQTSVWHCDIKKVMPDDPER
FDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRN
QTDLKALDLPSCSLTLTNNLDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYF
CPCLNDGGENKEPLHILHPQ
Download sequence
Identical sequences G3RQ26
ENSGGOP00000017898 XP_004056154.1.27298 ENSGGOP00000017898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]