SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017926 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017926
Domain Number 1 Region: 89-215
Classification Level Classification E-value
Superfamily Lysozyme-like 2.06e-46
Family C-type lysozyme 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017926   Gene: ENSGGOG00000001125   Transcript: ENSGGOT00000030098
Sequence length 216
Comment pep:known_by_projection chromosome:gorGor3.1:5:51165233:51170124:-1 gene:ENSGGOG00000001125 transcript:ENSGGOT00000030098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQEDHEGSQDGGVHSSPVSSPSVSGPRRLVSCLSSQSSALSQSGGGSTSAAGIEARSRA
LRRRWCPAGIMLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLA
YFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVI
CAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
Download sequence
Identical sequences G3RQ54
ENSGGOP00000017926 XP_018882066.1.27298 ENSGGOP00000017926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]