SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017939
Domain Number 1 Region: 38-63,183-360
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-53
Family G proteins 0.0000000308
Further Details:      
 
Domain Number 2 Region: 67-187
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.4e-34
Family Transducin (alpha subunit), insertion domain 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017939   Gene: ENSGGOG00000009488   Transcript: ENSGGOT00000022640
Sequence length 363
Comment pep:known_by_projection chromosome:gorGor3.1:7:2720324:2837237:-1 gene:ENSGGOG00000009488 transcript:ENSGGOT00000022640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVVRTLSRCLHAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMR
IIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKA
GLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSK
QDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYD
QVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFR
GDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDI
MLQ
Download sequence
Identical sequences F7HML6
ENSGGOP00000017939 ENSCJAP00000034834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]