SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017948 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017948
Domain Number 1 Region: 24-102
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 4.58e-28
Family Surp module (SWAP domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 670-779
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.98e-27
Family Ubiquitin-related 0.00000201
Further Details:      
 
Domain Number 3 Region: 136-216
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.16e-26
Family Surp module (SWAP domain) 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017948   Gene: ENSGGOG00000012631   Transcript: ENSGGOT00000031266
Sequence length 781
Comment pep:known_by_projection chromosome:gorGor3.1:22:14424245:14446517:-1 gene:ENSGGOG00000012631 transcript:ENSGGOT00000031266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERRVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQE
RYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPP
ETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIG
LLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEE
IQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNE
IPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGS
VIAPMPPIILAPSISPVPPAVLCCPIWAASQVPLPVFAAFVPAPPVAPVPAPAPMPPVHP
PPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLP
LTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRK
K
Download sequence
Identical sequences ENSGGOP00000017948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]