SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017954 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017954
Domain Number 1 Region: 5-411
Classification Level Classification E-value
Superfamily Sema domain 9.29e-49
Family Sema domain 0.0087
Further Details:      
 
Domain Number 2 Region: 1008-1137,1311-1460
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 413-461
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000615
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017954
Domain Number - Region: 623-709
Classification Level Classification E-value
Superfamily E set domains 0.000672
Family E-set domains of sugar-utilizing enzymes 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017954   Gene: ENSGGOG00000002553   Transcript: ENSGGOT00000032264
Sequence length 1527
Comment pep:known_by_projection chromosome:gorGor3.1:12:93209216:93375700:1 gene:ENSGGOG00000002553 transcript:ENSGGOT00000032264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEQAIGAIAASQEDGVFVASGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRP
GSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLGNLSRSSLRNGTEVVSCHPQGS
TAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELG
RLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASL
DCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQGRRSPTTTALCLFRMSEIQARAK
RVSWDFKTAESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLK
VILGENLTSNCPEVIYEIKEETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSC
SECLTATDPHCGWCHSLQRCTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSREKTTV
TMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSIPTRATYRDVSVVNVMFSFGSW
NLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKT
SGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTS
TCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFP
ATTWISGGQNITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTN
VTVKLRVQDTYLDCGTLQYREDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITL
FHGENGQLNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESV
PSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQM
DKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALIC
NKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQ
PKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKAL
YTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAF
LSKNGSPYGLQLNEIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIK
VFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAI
HSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVN
ILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEE
VKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLER
ERGLEEAQKQLLHVKVLFDEKKKCKWM
Download sequence
Identical sequences G3RQ81
ENSGGOP00000017954 ENSGGOP00000017954 XP_004053736.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]