SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017988 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017988
Domain Number 1 Region: 181-369
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-49
Family Reprolysin-like 0.00017
Further Details:      
 
Domain Number 2 Region: 390-465
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.3e-22
Family Blood coagulation inhibitor (disintegrin) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017988   Gene: ENSGGOG00000028582   Transcript: ENSGGOT00000027432
Sequence length 677
Comment pep:novel chromosome:gorGor3.1:8:17175430:17177894:1 gene:ENSGGOG00000028582 transcript:ENSGGOT00000027432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSIMAVGDPPVQARITLLLLCLGVFLFLSGWPQIAHCQYHSPPEVVIPVRITGIGRNIKL
PGWLSYSLCFGEQRHIVHMKAKKNLISRYLSVFSYTDQGALLEDQPFVQSDCYYHGYMEG
DPESLVTLSTCFGIPRVNDVVYEIKPKGFLPYFHLVYKLDSKETQFPPLGCGLTEEEIRT
HRWLLELAVVVDCTRFLYQKRNISNVQKDVSLIINEVDAFYSSVEVDVVLLGIEILIKGN
LIAINDLYAVLPEFCKWKKVSLNSRIKHDAVHLIVKKGYGRFAGLSYLGTGCTLAGNCGV
VSFLDDQMLRFAFIMAHELGHTLGTPHDRSPCTCGERICIMCPTVNITYRFSSCCYEMLF
ATTVKTTCLRGSPNPENIFTHKYCGNGVFEEGEECDCGSLFLCTQDLCCLANCTLKPGAA
CAFGLCCKDCQFLPSGHLCREKHNECDLSEWCNGTSHNCPEDVYVQDGLGCVDSGYRCQK
GCRNHDGQCKHIFGKVAKSANQSCYRVNTDGDFGDYGFNNTKYVGCNISDILCGRVQCEN
MTEIPILRDHSMMHWAHFNGINSWSADYHFGMTILDIGEMKDGTECGSKHVCTHRKCVPL
PFEESTCSPDTCNMRGICNNKHHCHCNYKWAPPYCLLKGTGGSVDSGPSPRKNKTMIEQV
FITLSNFRGTCLFVFFS
Download sequence
Identical sequences ENSGGOP00000017988 ENSGGOP00000017988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]