SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017991 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017991
Domain Number 1 Region: 40-128,277-403,869-1099
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-57
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 2 Region: 397-421,605-714,793-863
Classification Level Classification E-value
Superfamily HAD-like 1.99e-33
Family Predicted hydrolases Cof 0.063
Further Details:      
 
Domain Number 3 Region: 416-656
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.05e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.016
Further Details:      
 
Domain Number 4 Region: 126-195,235-274
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.49e-16
Family Calcium ATPase, transduction domain A 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017991   Gene: ENSGGOG00000014012   Transcript: ENSGGOT00000034323
Sequence length 1188
Comment pep:known_by_projection chromosome:gorGor3.1:13:96000148:96096200:1 gene:ENSGGOG00000014012 transcript:ENSGGOT00000034323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLTLLSFPQCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPK
NLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHKADN
AMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASL
DGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRP
LGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNYQSKSQKRSAVEKSMNAFLIVYLCI
LISKALINTVLKYVWQSEPFRDEPWYNRKTESERQRNLFLKAFTDFLAFMVLFNYIIPVS
MYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENN
MEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQV
KDDDSVDGPRKSPDGGRSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHVE
RFELLEILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAV
EGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLGATAVED
RLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSL
HDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL
FLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVI
GKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFF
CGFSQQTLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWR
VFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALD
THYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLV
TVSLLPDVLKKVLCRQLWPTATERVQNGCAQPRDHDSEFTPLASLQSPGYQSTCPSAAWY
SSHSQQVTLAAWKEKVSTEPPPTLGSSRHHCSSIPSHSCPRSRVGMLV
Download sequence
Identical sequences ENSGGOP00000013684 ENSGGOP00000017991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]