SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018025 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018025
Domain Number 1 Region: 91-194
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-31
Family SH2 domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000042
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018025   Gene: ENSGGOG00000012883   Transcript: ENSGGOT00000023552
Sequence length 261
Comment pep:known_by_projection chromosome:gorGor3.1:20:34052573:34089921:-1 gene:ENSGGOG00000012883 transcript:ENSGGOT00000023552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLPSRRKSLPSPSLSSSVQGQGPMTMEAERSKATAVALGSFPAGGPAELSLRLGEPLT
IVSEDGDWWTVLSEVTGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRKGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA
DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSEG
LRESLSSYISLNDEAVSLDDA
Download sequence
Identical sequences G3RAU1
XP_004062140.1.27298 XP_004062142.1.27298 ENSGGOP00000012570 ENSGGOP00000012570 ENSGGOP00000018025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]