SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018036 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018036
Domain Number 1 Region: 138-278
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.36e-28
Family FHA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018036   Gene: ENSGGOG00000028012   Transcript: ENSGGOT00000033723
Sequence length 796
Comment pep:known_by_projection chromosome:gorGor3.1:2a:28127228:28172799:1 gene:ENSGGOG00000028012 transcript:ENSGGOT00000033723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISRLHRSRMADILS
QSETLASQDLSGDFKKPALPVSPAARSKAPATSSSNPEEVQKEGPTALQDSNSGEPDIPP
PQPDCGDFRSLQEEQSRPPTAVSSPGGPARAPPYQEPPWGGPASAPYSLETLKGGTILGT
RSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTH
GTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQ
ILLEKKMLGEDSDEGEEMDTSERKINAGSQDDEMGCTWGMGEDAVEDDAEENPIVLEFQQ
EREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHS
GKKKEAMIQCSLEACRILDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLIEK
KRLNRMKKAGKIDEKPETFESLVAKLNDAERELSEISERLKASSQVLSESPSQDSLDAFM
SEIKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKIVKPAEIPELKKTETQTTGAENKA
KKLTLPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPTLMRMKDEPEVEEEEEEEEEEEKE
KEEHEKKKLEDGSLSRPQPEIEPEAAVQEMRPPTDLTHFKETQTHENMSQLSEEEQNKDY
QDCSKTTSLCAGPSASRNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDDPDYCVWVPPE
GQSGDGRTHLNDKYGY
Download sequence
Identical sequences G3RQG3
ENSGGOP00000018036 XP_004029073.1.27298 ENSGGOP00000018036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]