SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018043 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018043
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.69e-46
Family Adenylyltransferase 0.00000000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018043   Gene: ENSGGOG00000012306   Transcript: ENSGGOT00000025690
Sequence length 215
Comment pep:known_by_projection chromosome:gorGor3.1:3:139773557:139898366:-1 gene:ENSGGOG00000012306 transcript:ENSGGOT00000025690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVL
RHHHSELLRSPPQMEGPDHGKALFLTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIV
EKFGLVCVGRVGHDPKGYISESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKY
LIPDAVITYIKDHGLYTKGSTWKGKSTQSAEGKTS
Download sequence
Identical sequences XP_018879072.1.27298 ENSGGOP00000018043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]