SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018048 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018048
Domain Number 1 Region: 52-395
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 5.11e-102
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.00000000000263
Further Details:      
 
Domain Number 2 Region: 412-543
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000171
Family CBS-domain pair 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018048   Gene: ENSGGOG00000010251   Transcript: ENSGGOT00000025075
Sequence length 551
Comment pep:novel chromosome:gorGor3.1:21:31726568:31752459:-1 gene:ENSGGOG00000010251 transcript:ENSGGOT00000025075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGPPEDKEAKEPLWIRPDAPSRCTWQLGRPA
SESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD
RISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDV
LRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTT
YEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKA
AQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELSLS
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIHLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLL
NFVAAQERDQK
Download sequence
Identical sequences G3RQH5
XP_004062921.1.27298 ENSGGOP00000018048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]