SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018077 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018077
Domain Number 1 Region: 75-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.28e-16
Family TRASH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 637-955,1036-1107
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000273
Family Hermes transposase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018077   Gene: ENSGGOG00000028505   Transcript: ENSGGOT00000029311
Sequence length 1144
Comment pep:known_by_projection chromosome:gorGor3.1:1:36275382:36314941:1 gene:ENSGGOG00000028505 transcript:ENSGGOT00000029311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLLGGECDKAVASQLGLLDEIKTEPDNAQEYCHRQQSRTQENELKINAVFSESASQL
TAGIQLSLASSGMNKMLPSVSTTAIQVSCAGCKKILQKGQTAYQRKGSAQLFCSIPCITE
YISSASSPVSSKRTCSNCSKDILNPKDVISVQLEDTTTTSCKTFCSLSCLSSYEEKRKPF
VTICTNSILTKCSMCQKTAIIQYEVKYQNVKHNLCSNACLSKFHSANNFIMNCCKNCGTY
CYTSSSLSHILQMEGQSHYFNSSKSITAYKQKPAKPLISVPCKPLKPSDEMIETTSDLGK
TELFCSINCFSAYSKAKMESSSVSVVSVVHDTSTELLSPKKDTTPVISNIVSLADTDVAL
PIMNTDVLQDTVSSVTATADVIVDLSKSSPSEPSNAVASSSTEQPSVSPSSSVFSQHAIG
SSIEVQKDNMKSMKISDELCHPKCTSKVQKVKGKSRSIKKSCCEDFECLENSKKDVAFCY
SCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSD
DLSIHSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKG
EETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQ
LSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDS
TTNLRIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRNALKTLSSLFNTI
CMSGEMLADFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSS
NTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILE
CLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTS
TEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKHVQEFYK
LDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPI
TSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQELVNKLMEPERLNEIVEKFISQ
MKEI
Download sequence
Identical sequences G3RQK4
ENSGGOP00000018077 ENSGGOP00000018077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]