SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018155 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018155
Domain Number 1 Region: 373-480
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000298
Family FHA domain 0.011
Further Details:      
 
Domain Number 2 Region: 145-237
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000379
Family Ras-binding domain, RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018155   Gene: ENSGGOG00000001240   Transcript: ENSGGOT00000027060
Sequence length 913
Comment pep:known_by_projection chromosome:gorGor3.1:19:46007228:46028204:-1 gene:ENSGGOG00000001240 transcript:ENSGGOT00000027060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPL
PPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSGGAGGPGTPGGAQRWAS
EKKLPELAAGVAPEPPLATRATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEAL
ERYGLAGSPGGGPGESSCVDAFALCDAVGSGEWRAEHLRVLGDSERPLLVQEPWSRRPSG
PRTAKRNWRPRSRKKEQMIQWKRLSAGTGAPSWRPQKNRSRAASGGAALASPGPGTGSGA
PAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQIGPADPGDFDQ
LTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSPAPYVDTFL
NAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYK
DPRTGGSGPARPPWSGWAFSCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEI
VRAAAAGAGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGD
RQPENHPEGVPEVPLTPEAVSVELRPLMLWMANTTELLSFVQEKVLEMEKEADQEDPQLC
NDLELCDEAMALLDEVIMCTFQQSVYYLTKSLHHFLPFWLLFLCNHHQKKKKKVFRVPHS
DMLSQKVCSIILFSFLLKYLTKTVPHRHLFIYIKCLYDGSDISYIRHITFLQIAGSTPFP
TITLVINRLHSARKTLQRASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPA
EREAVDTGDIFESFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELP
ANYRHGPPVATSP
Download sequence
Identical sequences ENSGGOP00000018155 ENSGGOP00000001224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]