SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018206 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018206
Domain Number 1 Region: 326-475
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000393
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 2 Region: 160-253,307-340
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000496
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018206   Gene: ENSGGOG00000004599   Transcript: ENSGGOT00000030774
Sequence length 483
Comment pep:known_by_projection chromosome:gorGor3.1:8:16711017:16800155:1 gene:ENSGGOG00000004599 transcript:ENSGGOT00000030774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRRLLWPPPRLSPPLCAHQPLLGQWGRPAVTTLGLPGRPFSSREDEERLVGLVCYQL
YGDPRAGSPATGRPSKSAAAEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDLYATSR
ERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGS
SKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFR
KKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSD
LAERADDITSLVTDTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNT
ISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKGITFDEFRSFFQFLNNLEDFAIALNM
YNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHR
GFR
Download sequence
Identical sequences ENSGGOP00000018206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]