SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018221 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018221
Domain Number 1 Region: 112-283
Classification Level Classification E-value
Superfamily E set domains 1.75e-34
Family Arrestin/Vps26-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018221   Gene: ENSGGOG00000008862   Transcript: ENSGGOT00000033427
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:15:77985406:77998201:1 gene:ENSGGOG00000008862 transcript:ENSGGOT00000033427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWGPSTCPRASASAGALAVFSEVEYLNVRLSLREPPAGKRRPASSPLPHFSPLKMPLETR
ASGPVGISLPAHFGEVQFIVNWVLQKALVCVTRKLNIVNLVVVLLFEIFKTPVLKTQEKM
VGCWFFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCSSRLIVPKAAIFQTQTYLASGKT
KTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPSILDCCIIRVDYSLAVYIHIPGAKK
LMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSR
HIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEETQPVSFIL
Download sequence
Identical sequences ENSGGOP00000018221 ENSGGOP00000008664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]