SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018238 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018238
Domain Number 1 Region: 215-318
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-24
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 2 Region: 398-487
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.0000954
Further Details:      
 
Domain Number 3 Region: 12-83
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-17
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 4 Region: 76-110
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000981
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018238   Gene: ENSGGOG00000025388   Transcript: ENSGGOT00000032161
Sequence length 1036
Comment pep:known_by_projection chromosome:gorGor3.1:12:38882337:39295352:1 gene:ENSGGOG00000025388 transcript:ENSGGOT00000032161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFALERFAEAVDPALKCKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRRCPLQCQPLA
PGELYRVLPLRSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRRGCPS
ELGGGEVPARGGCGPAPRAGRGGGARGGPPGGRCGRGRGPGPRVLAWRRREKALLAQLWA
LQGEVQLTARRYQEKFTQYMAHVRNFVGDLGGGHRRDGEHKPFTIVLERENDTLGFNIIG
GRPNQNNQEGTSTEGIYVSKILENGPADRADGLEIHDKIMEVNGKDLSKATHEEAVEAFR
NAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDIC
PFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCY
RTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECKRIV
LLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNETMQPTANEVEQPKKQEEEEGTTD
TATSSSNNHEKDSGVGRTDESLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVEL
QYNESLVSGEYIDSDCIGNQDEDCERFRQLLELKCKIRNHGEYDLYYSSSTIECNQGEQE
GVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIWTLHDGGFRNYNTSIDMQRGK
LDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQ
SSSGQSSKESTSTKAKTTAQGCSAESKEKILEGSKLPDQEKAVSEHIPYLSPYHSSSYRY
ANIPAHARHYQSYMQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRY
ITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRR
EFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKS
PDGTRVHNAFLSVTTV
Download sequence
Identical sequences G3RR14
ENSGGOP00000018238 XP_004053016.1.27298 ENSGGOP00000018238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]