SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018273 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018273
Domain Number 1 Region: 3799-3993
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-37
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-31
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 3313-3424
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-31
Family Cadherin 0.00067
Further Details:      
 
Domain Number 4 Region: 2803-2911
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-28
Family Cadherin 0.00078
Further Details:      
 
Domain Number 5 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 1556-1657
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 810-924
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00091
Further Details:      
 
Domain Number 8 Region: 2276-2382
Classification Level Classification E-value
Superfamily Cadherin-like 3e-27
Family Cadherin 0.00055
Further Details:      
 
Domain Number 9 Region: 3017-3125
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-27
Family Cadherin 0.00057
Further Details:      
 
Domain Number 10 Region: 1020-1137
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 11 Region: 1759-1879
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 12 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 2069-2176
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-23
Family Cadherin 0.0026
Further Details:      
 
Domain Number 14 Region: 2912-3023
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 16 Region: 3417-3521
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 17 Region: 1450-1554
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-22
Family Cadherin 0.00091
Further Details:      
 
Domain Number 18 Region: 457-558
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 19 Region: 1660-1781
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 2176-2283
Classification Level Classification E-value
Superfamily Cadherin-like 5e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 21 Region: 2383-2483
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 22 Region: 3118-3171,3258-3311
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-20
Family Cadherin 0.0026
Further Details:      
 
Domain Number 23 Region: 2584-2694
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-19
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 2486-2596
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 25 Region: 1358-1456
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-18
Family Cadherin 0.0046
Further Details:      
 
Domain Number 26 Region: 1233-1353
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-17
Family Cadherin 0.0038
Further Details:      
 
Domain Number 27 Region: 1872-1969
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 28 Region: 1978-2081
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000314
Family Cadherin 0.0016
Further Details:      
 
Domain Number 29 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000828
Family Cadherin 0.0019
Further Details:      
 
Domain Number 30 Region: 2700-2809
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000014
Family Cadherin 0.0043
Further Details:      
 
Domain Number 31 Region: 367-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000003
Family Cadherin 0.0032
Further Details:      
 
Domain Number 32 Region: 4113-4151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000373
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 33 Region: 3526-3615
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0087
Further Details:      
 
Domain Number 34 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000571
Family Cadherin 0.009
Further Details:      
 
Domain Number 35 Region: 4078-4117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000435
Family EGF-type module 0.016
Further Details:      
 
Domain Number 36 Region: 4039-4075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 37 Region: 3998-4039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018273
Domain Number - Region: 273-352
Classification Level Classification E-value
Superfamily Cadherin-like 0.000571
Family Cadherin 0.0071
Further Details:      
 
Domain Number - Region: 3778-3809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0587
Family Laminin-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018273   Gene: ENSGGOG00000004402   Transcript: ENSGGOT00000031682
Sequence length 4574
Comment pep:known_by_projection chromosome:gorGor3.1:4:197439985:197569721:-1 gene:ENSGGOG00000004402 transcript:ENSGGOT00000031682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLALLLLLLLLFQRFGDSDGSQRLEQTPLQFTHLEYNVTVQENSAAKTYVGHPVKMG
VYITHPAWEVRYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSM
AKLTVHIEQANECAPVITAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLL
QQFRTVRSFPGSKEYKVKAIGGVDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPGYSHLRYVFKSTPGKAKFSLNYNTGLI
SILEPVKRQQAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGT
TVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVQYQIEAGNELDLFSLNPNSGVLSLKQSLMDGLGAKVSFHSLRITATDGENFATPLYIN
ITVAASRKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTL
LTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAISGGNEDSCFMIDMETGMLKILSPL
DRETTDKYTLNITVYDLGIPQKAAWRLLHVTVVDANDNPPEFLQESYFVEVSEDKEVHSE
IIQVEATDKDLGPNGHVTYSILTDTDTFSIDSVTGVVKIARSLDRELQHEHYLKIEARDQ
AREEPQLSSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSG
QVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDAGRDGEIRYSIRDGSGVG
VFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTS
RKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
DRERNARREPLYRVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKRFSAAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPSPEPISFEESFFTFTVMESDPVAHMIGVI
SVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILT
QVFIKVIDTNDHRPQFSTSKYEVIIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPL
SLKKFRLDPATGSLYTSGKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAP
WFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIK
TAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETV
SIGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGT
NMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADAD
KDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAE
YAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITE
GNIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKINVKESKESHLKFT
QDVYSAVVKENSTEAKTLAVITAVGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFD
REQQETFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVI
RYVTAVDRDSGRNGEVHYYLKEHHEHFQIGPLGEISLKKQFELDTLNKEYLVTVVAKDGG
NPAFSAEVIVPITVMNKAMPVFEKPFYSAEIAENIQVHSPVVHVQANSPEGLKVFYSITD
GDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVEDINDNP
PVFAQQSYAATLSEASVIGTSVVQVRATDSDSEPNRGISYQMFENHSKSHDHFHVDSSTG
LISLLRTLDYEQSRQHTIFVRAVDGGMPPLSSDVIVTVDVTDLNDNPPLFEQQIYEARIS
EHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNLRRHALKPF
YSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGD
SGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFC
TVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVIKVLASDADEGSNADITYAIEADSE
SVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESVVPVYVKILPPEMQL
PKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRL
KLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVE
NLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKR
DNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAIL
STTDADSEEINRQVTYFITGGDPLGQFAVENIQNEWKVYVKKPLDREKRDNYLLTITATD
GTFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITY
TLLGSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVND
NAPEFSADPYAITVFENTEPGTLLTRVQATDADAGISRGCSCLTLLTEILGASVSKHTPD
SACATHSTSCMFHSPSLWKEIRITSSVIVFILLIKLEWSELWYGRDDTIIMFIISRDVGG
VDGESNLNIMKNIMKIVENAGSNFDFYSGAVFIIENLDYESSHEYYLTVEATDGGTPSLS
DVASVNINVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIID
GNQGSSFTIDPVRGEVKVTRLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDN
APVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNPQGV
LLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITASG
EEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGGKLIAHKKLDIGQYLLNVSV
TDGKFTTVADITVHIRQVTQEMLNHTIAIRFANLTPEEFVGDYWRNFQRALRNILGVRRN
DIQIVSLQSSEPHPHLDVLLFVEKPGSAQITTKQLLHKINSSVTDLEEIIGVRILNVFQK
LCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCPPVHHGCED
NPCPEGSECVSDPREEKHTCVCPGGRFGQCPGSSSMTLTGNSYVKYRLTENENKLEMKLT
MRLRTYSTHAVVMYARGTDYSILEIHHGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVAL
EVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQGTRHGRSPQVGNGFRGC
MDSIYLNGQELPLNSKPRSYAHIEESVDVSPGCLLTATEDCASNPCQNGGVCNPSPAGDL
GYYCKCSALYIGTHCEISVNPCSSNPCLYGGTCVVDNGGFVCQCRGLYTGQRCQLSPYCK
DEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECSGNPCLHGALCENTHGSYHCNCS
HEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIVVFIAGIFLLVVVFVLCRKMITRKKKHQA
EPEDKHLGPATAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDSRNNLDRNSFE
GSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDT
KVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNGYHWDTSDWMPSVPL
PDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPE
FSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCRE
SHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEE
VTIPPLDSQQHTEV
Download sequence
Identical sequences ENSGGOP00000004325 ENSGGOP00000018273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]