SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018321 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018321
Domain Number 1 Region: 172-429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.47e-61
Family Protein kinases, catalytic subunit 0.00000000323
Further Details:      
 
Domain Number 2 Region: 32-160
Classification Level Classification E-value
Superfamily SH2 domain 8.4e-39
Family SH2 domain 0.00000119
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000834
Family SH3-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018321   Gene: ENSGGOG00000007437   Transcript: ENSGGOT00000026168
Sequence length 438
Comment pep:known_by_projection chromosome:gorGor3.1:20:34868650:34888009:1 gene:ENSGGOG00000007437 transcript:ENSGGOT00000026168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAE
EWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRK
LDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRES
LRLEVKLGQGCFGEVWMGMGPRSHIKGTSRPAGTRTWIKHAGLECSFPQSPTVRKADSSA
VIFKLISPGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVG
ENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTEL
TTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAF
LEDYFTSTEPQYQPGENL
Download sequence
Identical sequences ENSGGOP00000018321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]