SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018329 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018329
Domain Number 1 Region: 117-204
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.7e-42
Family variant PHD-like domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 196-277
Classification Level Classification E-value
Superfamily EF-hand 0.00000775
Family EF-hand modules in multidomain proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018329   Gene: ENSGGOG00000000397   Transcript: ENSGGOT00000027168
Sequence length 401
Comment pep:known_by_projection chromosome:gorGor3.1:9:35682626:35693830:1 gene:ENSGGOG00000000397 transcript:ENSGGOT00000027168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKE
AEAGTSVVQEESSAGRAAWERLRDGRGVEPEEFDRTSQFTPPAFIRPTRKLDDDKPPEIC
LEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTE
TGWSCHYCCYTPNLLLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRA
LSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERAR
AAFLARGSGSTVSEAECRRAQHSWFCKWFPEAPSCSVSISHVGPIADSSPASSSSKSQDK
TLLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPPG
Download sequence
Identical sequences ENSGGOP00000018329 ENSGGOP00000000391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]